PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0011s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 246aa    MW: 27131.4 Da    PI: 7.4249
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0011s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1282.7e-4052111362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++alkcprCds++tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  SapurV1A.0011s0080.1.p  52 DQALKCPRCDSAHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 111
                             7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2752109IPR003851Zinc finger, Dof-type
PfamPF027018.1E-3452109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.07855109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGLTSLQVCM DSSDWLQGTI NEDSGMDSSS PSGDMMTCSR PLIERRLRPP LDQALKCPRC  60
DSAHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV SKKSNDQSVN  120
QINPGSSSSH NPTDLHLSFP EVQLSHLHNI LGSQETFANP NFMESKYNIG MLENPRPVDF  180
MDSKLEAFVG SSRNYDFMGN GDLGMVSGLG DMSHHHGLAP NFSGFCSSFG MSLDGNSGTF  240
METCQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028560.11e-165PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM034e-51DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLB9IES21e-164B9IES2_POPTR; Uncharacterized protein
STRINGPOPTR_0015s08810.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50923456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-42Dof family protein